<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CW-RB22 RB22 South Africa 1999 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39E, S48T, V118I, D121Y, K122E, D123X, Y144F, K173A, D177E, I178L, T200A, K201R, E204K, Q207E, V245Q, D250E, A272P, Q278R, L279M, T286A, E291D, I293V I135F
>RB22| codons 26-302
LTEEKIKALTAICEEMEKEGKITKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQ
DFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPLYEXFRKYTAFTIPSFNNETPGIRFQ
YNVLPQGWKGSPAIFQSSMTKILEPFRAQNPELVIYQYMDDLYVGSDLEIGQHRARIEKL
REHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIQLPEKESWTVNDIQKLVGKLN
WASQIYPGIKVKRMCKLLRGAKALTDVVPLTEEAELE

References
Author Title Citation
Willliamson, C Characterization and selection of HIV-1 subtype C isolates for use in vaccine development. ARHR, 2003