<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NG010499 NG010499 Nigeria 2009 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    V31I, L101I, G106A, T112V, T124A, T125A, G134D, D167E, V201I, T206S, D207E, I208L, L234I S283G
>NG010499| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAARWPVKVIHTDNGSN
FTSAAVKAACWWADIKQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASELQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, G16E, K20R, E35D, M36I, R41K, K43R, L63T, H69K, L89M  
>NG010499| codons 1-99
PQITLWQRPVVTVKIEGQLREALLDTGADDTVLEDINLPGKWRPKMIGGIGGFIKVRQYD
QITIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39N, V60I, D121H, K122E, I142V, Q174E, D177E, T200A, Q207A, R211K, V245M, K277R, T286A, I293V, P294T, I326V, G335D, R356K, M357K, G359S, A371V, I375V, K385R, A400T, T403M, E432D, V435L, T470N, D471E, T477A, H483Y, L491P, I495V, S519N, Q524K, K527G, A534S, A554S Y127YC, D186DG
>NG010499| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICNEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEDFRKCTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKENPEIVI
YQYMDGLYVGSDLEIGQHRAKIEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTEVVTLTEEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKRSA
HTNDVKQLTEVVQKVATESIVIWGRTPKFKLPIQKETWETWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPILGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSLNETTNQKAELQ
AIYLALQDSGPEVNVVTDSQYALGIIQAQPDKSESELVNQIIEKLIGKEKVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Heipertz, RA Jr. Significant contribution of subtype G to HIV-1 genetic complexity in Nigeria identified by a newly developed subtyping assay specific for subtype G and CRF02_AG. Medicine (Baltimore), 2016