<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1268 CA3745 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 Unknown 52
3 3TC+AZT+SQV 26
4 3TC+D4T+IDV 26
5 3TC+AZT+RTV+SQV 19

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54T, V82A, L90M M46MV L10I, I15V, E35D, M36I, K43N, I62V, L63P, A71V  
>CA3745| codons 1-99
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEDINLPGRWNPKVIVGIGGFTKVRQYD
QVPIEICGHKVIGTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005