<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
apv10 apv10M6 France 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ DDI+ NFV 24

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K20R, R57K, I62V, L63P, A71T, V77I, I93L  
>apv10M6| codons 1-99
PQITLWQRPLVTIKIGGQLREALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVKQYD
QVPIEICGHKTIGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        Q207E  
>apv10M6| codons 38-239
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGFTTP
DKKHQKEPPFLWMGYELHPDKW

References
Author Title Citation
Masquelier, B Mechanisms of early virologic failure in antiretroviral-naive patients starting protease inhibitor-containing regimens: The APROVIR study. J Infect Dis, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005