<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
apv9 apv9M8 France 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ NFV 32

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   K14R, N37S, R41K, I64V  
>apv9M8| codons 1-99
PQITLWQRPLVTIRIGGQLKEALLDTGADNTVLEEMSLPGKWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V K219Q     V60I, R83K, V90I, K122E, I135T, S162Y, T200A  
>apv9M8| codons 36-234
EICTEMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKKTQDFWEIQLGIP
HPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKG
SPAIFQYSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGFT
TPDQKHQKEPPFLWMGYEL

References
Author Title Citation
Masquelier, B Mechanisms of early virologic failure in antiretroviral-naive patients starting protease inhibitor-containing regimens: the APROVIR study. J Infect Dis, 2002
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005