<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AS-42 AS-42 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 29
2 None 16
3 D4T+NFV 43
4 D4T+DDI+NFV 68
5 None 14
6 DDI 1

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M F77L, F116Y     V35T, V90I, D123E, I142V, D177E  
>AS-42| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDLRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYYSVPL
DKEFRKYTAFTIPSINNETPGVRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>AS-42| C1 | codons 1-229 | clone C1
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDLRELNKRTQDFWEIQLGIPHPAGLKRKKSVTVLDVGDAYYSVPL
DKEFRKYTAFTIPSINNETPGVRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>AS-42| C2 | codons 1-229 | clone C2
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDLRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYYSVPL
DKEFRKYTAFTIPSINNETPGVRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKPQKDPPFLW
>AS-42| C3 | codons 1-229 | clone C3
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDLGELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYYSVPL
DKEFRKYTAFTIPSINNETPGVRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIVELRQHLLRWGFTTPDKKHQKEPPFLW
>AS-42| C4 | codons 1-229 | clone C4
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDLRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYYSVPL
DKEFRKYTAFTIPSINNETPGVRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>AS-42| C5 | codons 1-229 | clone C5
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQGFWEIQLGIPHPAGLKKKKSVTVLDVGDAYYSVPL
DKEFRKYTAFTIPSINNETPGVRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>AS-42| C6 | codons 1-229 | clone C6
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEVCTEMEKEGKISKIGPENPYNTPV
FVIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYYSAPL
DKEFRKYTAFTIPSINNETPGVRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>AS-42| C7 | codons 1-229 | clone C7
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYYSVPL
DKEFRKYTAFTIPSINNETPGVRYRYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>AS-42| C8 | codons 1-229 | clone C8
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDLRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYYSVPL
DKEFRKYTAFTIPSINNETPGVRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M Q58E, G73S L10I, D60E, I62V, L63T, A71V, T74S, V77I  
>AS-42| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVREYE
QVTIEICGHKVISSVLIGPTPVNIIGRNLMTQIGCTLNF
>AS-42| C1 | codons 1-99 | clone C1
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVREYE
QVTMEICGHKVISAVLIGPTPVNIIGRNLMTQIGCTLNF
>AS-42| C2 | codons 1-99 | clone C2
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVREYE
QVTIEICGHKVISAVLIGPTPVNIIGRNLMTQIGCTLNF
>AS-42| C3 | codons 1-99 | clone C3
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVREYE
QVTIEICGHKVISAVLIGPTPVNIIGRNLMTQIGCTLNF
>AS-42| C4 | codons 1-99 | clone C4
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVREYE
QVTIEICGHKVISAVLIGPTPVNIIGRNLMTQIGCTLNF
>AS-42| C5 | codons 1-99 | clone C5
PQITLWQRPIVTIKIGGQLMEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QVTIDICGHKVIGSVLIGPTPVNIIGRNLMTQIGCTLNF
>AS-42| C6 | codons 1-99 | clone C6
PQITLWQRPIVTIKIGGQLMEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QVTIDICGHKVIGSVLIGPTPVNIIGGNLMTQLGCTLNF
>AS-42| C7 | codons 1-99 | clone C7
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVREYE
QVTIEICGHKVISAVLIGPTPVNIIGRNLMTQIGCTLNF
>AS-42| C8 | codons 1-99 | clone C8
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVREYE
QVTIEICGHKVISAVLIGPTPVNIIGRNLMTQIGCTLNF

References
Author Title Citation
Saah, AJ Treatment with indinavir, efavirenz, and adefovir after failure of nelfinavir therapy. J Infect Dis, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005