<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AS-41 AS-41 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+3TC+NFV 68

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   I15V, K20T, M36I, D60E, I62V, T74A, L89I  
>AS-41| codons 1-99
PQITLWQRPLVTIKVGGQLTEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYE
QVLIEICGHKAIGAVLVGPTPVNIIGRNIMTQIGCTLNF
>AS-41| C1 | codons 1-99 | clone C1
PQITLWQRPFVTVKVGGQLTEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYE
QVLIEICGHKAIGAVLVGPTPVNIIGRNIMTQIGCTLNF
>AS-41| C2 | codons 1-99 | clone C2
PQITLWQRPLVTVKVGGQLTEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYE
QVLIEICGHKAIGTVLVGPTPVNIIGRNIMTQIGCTLNF
>AS-41| C3 | codons 1-99 | clone C3
PQITLWQRPLVTVKVGGQLTEALLDTGADDTVLEEITLPGRWKPKMIGGIGGFIKVRQYE
QVLIEICGHKAIGAVLVGPTPVNIIGRNIMTQIGCTLNF
>AS-41| C4 | codons 1-99 | clone C4
PQITLWQRPFVTVKVGGQLTEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYE
QVLIEICGHKAIGAVLVGPTPVNIIGRNIMTQIGCTLNF
>AS-41| C5 | codons 1-99 | clone C5
PQITLWQRPLVTVKVGGQLTEALLDTGADDTVLEGINLPGRWKPKMIGGIGGFIKVRQYE
QVLIEICGHKAIGTVLVGPTPVNIIGRNIMTQIGCTLNF
>AS-41| C6 | codons 1-99 | clone C6
PQITLWQRPLVTVKVGGQLTEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYE
QVLIEICGHKAIGAVLVGPTPVNIIGRNIMTQIGCTLNF
>AS-41| C7 | codons 1-99 | clone C7
PQITLWQRPLVTVRVGGQLTEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYE
QVLIEICGHKAIGTVLVGPTPVNIIGRNIMTQIGCTLNF
>AS-41| C8 | codons 1-99 | clone C8
PQITLWQRPLVTVKVGGQLTEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYE
QVLIEICGHKAIGAVLVGPTPVNIIGRNIMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       K20R, T27S, K122E, I135T, I142M, F214L  
>AS-41| codons 1-229
PISPIETVPVKLKPGMDGPRVKQWPLSEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGMRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLW
>AS-41| C1 | codons 1-229 | clone C1
PISPIETVPVKLKPGMDGPRVKQWPLSEEKIKALEEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSAPL
DEDFRKYTAFTIPSTNNETPGMRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLW
>AS-41| C2 | codons 1-229 | clone C2
PISPIETVPVKLKPGMDGPRVKQWPLSEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGMRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLW
>AS-41| C3 | codons 1-229 | clone C3
PISPIETVPVKLKPGMDGPKVKQWPLSEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGMRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLW
>AS-41| C4 | codons 1-229 | clone C4
PISPIETVPVELKPGMDGPKVKQWPLSEEKIKALVEICTEMEKEGKISKIGPENLYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTMPSTNNETPGMRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLW
>AS-41| C5 | codons 1-229 | clone C5
PISPIETVPVKLKPGMDGPRVKQWPLSEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGMRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLW
>AS-41| C6 | codons 1-229 | clone C6
PISPIETVPVKLKPGMDGPRVKQWPLSEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGMRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLGWGLTTPDKKHQKEPPFLW
>AS-41| C7 | codons 1-229 | clone C7
PISPIETVPVKLKPGMDGPRVKQWPLSEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDTYFSVPL
DEDFRKYTAFTIPSTNNETPGMRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLW
>AS-41| C8 | codons 1-229 | clone C8
PISPIETVPVKLKPGMDGPKVKQWPLSEEKMKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFREVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGMRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLW

References
Author Title Citation
Saah, AJ Treatment with indinavir, efavirenz, and adefovir after failure of nelfinavir therapy. J Infect Dis, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005