<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AS-40 AS-40 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+3TC 34
2 AZT+NFV+3TC 30
3 3TC+AZT+NFV 36
4 3TC+D4T+NFV 13

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M Q58E L19I, K20T, M36I, I62V, L63S, I64V, V77I, I93L  
>AS-40| codons 1-99
PQITLWQRPLVTIKIGGQITEALLDTGADDTVLEEINLPGRWKPKIIGGIGGFIKVREYD
QVSVEICGHKAIGTVLIGPTPVNIIGRNLMTQLGCTLNF
>AS-40| C1 | codons 1-99 | clone C1
PQITLWQRPLVTVKIGGQLTEALLDTGADDTVLEEINLPGRWKPKIIGGIGGFIRVREYD
QVSVEICGHKAIGTVLIGPTPVNIIGRNLMTQLGCTLNF
>AS-40| C2 | codons 1-99 | clone C2
PQITLWQRPLVTIKIGGQMIEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYE
QVSVEICGHKVIGTVLIGPTPVNIIGRNLMTQLGCTLNF
>AS-40| C3 | codons 1-99 | clone C3
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVREYD
QVSVEICGHKAIGSVLIGPTPVNIIGRNLMTQLGCTLNF
>AS-40| C4 | codons 1-99 | clone C4
PQITLWQRPLVTIKIGGQIIEALLDTGADDTVLEEINLPGRWKPKIIGGIGGFIKVREYD
QVSVEICGHKATGTVLIGPTPVNIIGRNLMTQLGCTLNF
>AS-40| C5 | codons 1-99 | clone C5
PQITLWQRPLVTIKIGGQIIEALLDTGADDTVLEEINLPGRWKPKIIGGIGGFIKVREYD
QVSVEICGHKAIGTVLIGPTPVNIIGRNLMTQLGCTLNF
>AS-40| C6 | codons 1-99 | clone C6
PQITLWQRPLVTIKIGGQIIEALLDTGADDTVLEEINLPGRWKPKIIGGIGGFIKVREYD
QVSVEICGHKATGTVLIGPTPVNIIGRNLMTQLGCTLNF
>AS-40| C7 | codons 1-99 | clone C7
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVREYD
QVSVEICGHKAIGTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       R83K, K102Q, T200A  
>AS-40| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>AS-40| C1 | codons 1-229 | clone C1
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDLRELNKKTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPL
DKNFRKYTAFTIPSINNETPGIKYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLHVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>AS-40| C2 | codons 1-229 | clone C2
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>AS-40| C3 | codons 1-229 | clone C3
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIEKKNSTRWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFPW
>AS-40| C4 | codons 1-229 | clone C4
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPGNPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>AS-40| C5 | codons 1-229 | clone C5
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVNDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>AS-40| C6 | codons 1-229 | clone C6
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHPLRWGFTTPDKKHQKEPPFLW
>AS-40| C7 | codons 1-229 | clone C7
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW

References
Author Title Citation
Saah, AJ Treatment with indinavir, efavirenz, and adefovir after failure of nelfinavir therapy. J Infect Dis, 2003