<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
65540_483 65540_483 Uganda 2012 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, Y115F, M184V   K103S, G190A   S48T, V60I, W88WS, V90VI, V118VI, K122E, I135V, T165I, K173T, Q174R, D177E, I178M, V179VI, T200A, Q207E, R211K I159L
>65540_483| codons 41-238
MEKEGKITKIGPENPYNTPIFAIKKKDSTKWRKVVDFRELNKRTQDFSEIQLGIPHPAGL
KKSKSVTVLDVGDAFFSIPLDEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPALF
QSSMIKILEPFRTRNPEMIIYQYVDDLYVASDLEIGQHRAKIEELREHLLKWGFTTPDKK
HQKEPPFLWMGYELHPDK

References
Author Title Citation
Kekitiinwa, A Virologic response to first-line efavirenz- or nevirapine-based anti-retroviral therapy in HIV-infected African children. Pediatr Infect Dis J, 2017