<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AS-38 AS-38 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+3TC+NFV 33

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L L10F, T74P T12I, I15V, L19T, L63T, I72V  
>AS-38| codons 1-99
PQITLWQRPFVIIKVGGQTKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFIKVRQYD
QITIEICGHKAVGPVLVGPTPVNIIGRNLLTQIGCTLNF
>AS-38| C1 | codons 1-99 | clone C1
PQITLWQRPFVIIKVGGQTKEALLDTGADGTVLEEMNLPGRWKPKLIGGIGGFIKVRQYD
QITIEICGHKAVGSVLVGPTPVNIIGRNLMTQIGCTLNF
>AS-38| C2 | codons 1-99 | clone C2
PQITLWQRPFVIIKIGGQTKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFIKVRQYD
QITIEICGHKAVGSVLVGPTPVNIIGRNLMTQIGCTLNF
>AS-38| C3 | codons 1-99 | clone C3
PQITLWRRPFVIIKVGGQTKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFIKVRQYD
QITIEICGHKAVGPVLVGPTPVNIIGRNLLTQIGCTLNF
>AS-38| C4 | codons 1-99 | clone C4
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYE
QIPIEICGQKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>AS-38| C5 | codons 1-99 | clone C5
PQITLWQRPLVIIKVGGQTKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFIKVRQYD
QITIEICGHKAVGAVLVGPTPFNIIGRNLLTQIGRTLNF
>AS-38| C6 | codons 1-99 | clone C6
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIRVRQYE
QIPIEICGHKAISTVLVGPTPVNIIGRNLLTRLGCTLNF
>AS-38| C7 | codons 1-99 | clone C7
PQITLWQRPFVIIKVEGQTKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFIKVRQYD
QITIEICGHKAVGPVLVGPTPVNIIGRNLLTQIGCTLNF
>AS-38| C8 | codons 1-99 | clone C8
PQITLWQRPFVIIKVEGQTKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFIKVRQYD
QITIEICGHKAVGSVLVGPTPVNIIGRNLMTQIGCTLNF
>AS-38| C9 | codons 1-99 | clone C9
PQITLWQRPFVIIKVEGQTKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFIKVRQYD
QITIEICGHKAVGPVLVGPTPVNIIGRNLLTQIGCTLNF
>AS-38| C10 | codons 1-99 | clone C10
PQITLWQRPFVIIKVEGQTKEALLDTGADDTVLEEMNLPGRWKPKLIGEIGGFIKVRQYD
QITIEICGHKAVGPVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       K20R, K49R, E169D, G196R, T200E, Q207E  
>AS-38| codons 1-229
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIRQHREKIEELREHLLRWGFTTPDKKHQKEPPFLW
>AS-38| C1 | codons 1-229 | clone C1
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIRQHREKIEELRKHLLR*GFTTPDKKHQKEPPFLW
>AS-38| C2 | codons 1-229 | clone C2
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFGELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIRQHREKIEELREHLLRWGFTTPDKKRQKEPPFLW
>AS-38| C3 | codons 1-229 | clone C3
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIRQHREKIEELREHLLRWGFTTPDKKHQKEPPFLW
>AS-38| C4 | codons 1-229 | clone C4
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDLWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPEIVV
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>AS-38| C5 | codons 1-229 | clone C5
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIRQHREKIEELREHLLRWGFTTPDKKHQKEPPFLW
>AS-38| C6 | codons 1-229 | clone C6
PISPVETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKEKKSVTVLDVGDAYFSVPL
DKDFRKHTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVSSDLEIGQHRTKIEELRQHLLRWGFFTPEQKHQKEPPFHW
>AS-38| C7 | codons 1-229 | clone C7
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIRQHREKIEELREHLLRWGFTTPDKKHQKEPPFLW
>AS-38| C8 | codons 1-229 | clone C8
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYLSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIRQHREKIEELREHLLRWGFTTPDKKHQKEPPFLW
>AS-38| C9 | codons 1-229 | clone C9
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIRQHREKIEELREHLLRWGFTTPDKKHQKEPPFLW
>AS-38| C10 | codons 1-229 | clone C10
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLTDFRELNKRTQDFWEVQLGIPHPAGLRKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
Y*YVDDLYVGSDLEIRQHREKVEELREHLLRWGFTTPDKKHQKEPPFLW

References
Author Title Citation
Saah, AJ Treatment with indinavir, efavirenz, and adefovir after failure of nelfinavir therapy. J Infect Dis, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005