<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
79390_304 79390_304 Uganda 2012 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, Y115F, M184V K219KE K103N, Y181YC K238T K122E, D123N, K173S, D177E, V179IT, V189I, Q197K, T200A, I202V, Q207A, L228LI  
>79390_304| codons 41-238
MEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGL
KKNKSVTVLDVGDAFFSVPLDENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRSQNPEITICQYVDDLYIGSDLEIGKHRAKVEELRAHLLRWGFTTPDEK
HQKEPPFIWMGYELHPDT

References
Author Title Citation
Kekitiinwa, A Virologic response to first-line efavirenz- or nevirapine-based anti-retroviral therapy in HIV-infected African children. Pediatr Infect Dis J, 2017