<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AS-36 AS-36 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NFV+AZT+3TC 41

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   L10I, N37D, D60E, L63P, I66F, A71T, I72L, V77I  
>AS-36| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYE
QIPIEFCGHKTLGTVLIGPTPVNIIGRNLMTQIGCTLNF
>AS-36| C1 | codons 1-99 | clone C1
PQITLLQRPIVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYE
QIPIEICGHKTLSTVLIGPTPVNIIGRNLMTQIGCTLNF
>AS-36| C2 | codons 1-99 | clone C2
PQITLWQRPIVTIEIGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYE
QIPIEFCGHKILGTVLIGPTPVNIIGRNLMTQIGCTLNF
>AS-36| C3 | codons 1-99 | clone C3
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYE
QIPIEICGHKTLSTVLIGPTPVNIIGRNLMTQIGCTLNF
>AS-36| C4 | codons 1-99 | clone C4
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRRYE
QIPIEICGHKTLSTVLIGPTPVNIIGRNLMTQIGCTLNF
>AS-36| C5 | codons 1-99 | clone C5
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYE
QIPIEFCGHKTLGTVLIGPTPVNIIGRNLMTQIGCTLNF
>AS-36| C6 | codons 1-99 | clone C6
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYE
QIPIEFCGHKILGTVLIGPTPVNIIGRNLMTQIGCTLNF
>AS-36| C7 | codons 1-99 | clone C7
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYE
QIPIEFCGHKILGTVLIGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       E6K, V60I, V118I, K122E, D123E, I135T, G196E, Q197K, T200I, F214L  
>AS-36| codons 1-229
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEKHRIKIEELRQHLLRWGLTTPDKKHQKEPPFLW
>AS-36| C1 | codons 1-229 | clone C1
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGEISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEKHRIKIEELRQHLLRWGLTTPDKKHQEEPPFLW
>AS-36| C2 | codons 1-229 | clone C2
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSTPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEKHRIKIEELRQHLLRWGLTTPDKKHQKEPPFLW
>AS-36| C3 | codons 1-229 | clone C3
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGKHRIKIEELRQHLLRWGLTTPDKKHQEEPPFLW
>AS-36| C4 | codons 1-229 | clone C4
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVT
YQYVDDLYVGSDLEIEKHRIKIEELRQHLLRWGLTTPDKKHQKEPPFLW
>AS-36| C5 | codons 1-229 | clone C5
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEKHRIKIEELRQHLLRWGLTTPDKKHQKEPPFLW
>AS-36| C6 | codons 1-229 | clone C6
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFGELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEKHRIKIEELRQHLLRWGLTTPDKKHQKEPPFLW
>AS-36| C7 | codons 1-229 | clone C7
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEKHRIKIEELRQHLLRWGLTTPDKKHQKEPPFLW

References
Author Title Citation
Saah, AJ Treatment with indinavir, efavirenz, and adefovir after failure of nelfinavir therapy. J Infect Dis, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005