<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AS-33 AS-33 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+3TC 48
2 D4T+NFV+3TC 14
3 3TC+NFV 20

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, L19I, K20T, E35G, I64V, T74S, V77I  
>AS-33| codons 1-99
PQITLWQRPIVTIKIGGQITEALLDTGADDTVLEGMNLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGSVLIGPTPVNIIGRNLLTQIGCTLNF
>AS-33| C1 | codons 1-99 | clone C1
PQITLWQRPLVTIRIGGQIKEALLDTGADDTVLEDVDLPGRWKPKMIGGIGGFIKVKQYD
QILVEICGHKAIGSVLIGPTPVNIIGRNLLTQIGCTLNF
>AS-33| C2 | codons 1-99 | clone C2
PQITLWQRPIVTIKIGGQVTEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVRQYD
QVLVEICGHKAIGSVLIGPTPVNIIGRNLLTQIGCTLNF
>AS-33| C3 | codons 1-99 | clone C3
PQITLWQRPLVTIRIGGQVTEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGSVLIGPTPVNIIGRNLLTQIGRTLNF
>AS-33| C4 | codons 1-99 | clone C4
PQITLWQRPLVTIRIGGQVTEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>AS-33| C5 | codons 1-99 | clone C5
PQITLWQRPIVTIRIGGQVTEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLVGPTPVNIIGRNLMTQIGCTLNF
>AS-33| C6 | codons 1-99 | clone C6
PQITLWQRPIVTIKIGGQVKEALLDTGADDTVLEDVNLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLVGPTPVNIIGRNLMTQIGCTLNF
>AS-33| C7 | codons 1-99 | clone C7
PQITLWQRPIVTIKIGGQVTEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGSVLIGPTPVNIIGRNLLTQIGCTLNF
>AS-33| C8 | codons 1-99 | clone C8
PQITLWQRPIVTIKIGGQVTEAPLDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGSVLIGPTPVNIIGRNLLTQIGCTLNF
>AS-33| C9 | codons 1-99 | clone C9
PQITLWQRPLVTIKIGGQVTEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGSVLIGPTPVNIIGRNLLTQIGCTLNF
>AS-33| C10 | codons 1-99 | clone C10
PQITLWQRPIVTIKIGGQVTEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGSVLIGPTPVNIIGGNLMTQIGCTLNF
>AS-33| C11 | codons 1-99 | clone C11
PQITLWQRPIVTIKIGGQVTEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGSVLIEPTPVNIIGRNPLTQLGCTLNF
>AS-33| C12 | codons 1-99 | clone C12
PQITLWQLPLVTIRIGGQVTEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYD
QLLVEICGHKAIGSVLIGPTPVNIIGRNLLTQIGCTLNF
>AS-33| C13 | codons 1-99 | clone C13
PQITLWQRPIVTIKIGGQVTEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYE
QITIEFCGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>AS-33| C14 | codons 1-99 | clone C14
PQITLWQRPLVTIKIGGQGTEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVRQYD
QIPVEICGHKAIGSVLIGPTPVNIIGRNLLTQIGCTLNF
>AS-33| C15 | codons 1-99 | clone C15
PQITLWQRPLVTIRIGGQVTEALLDTGADDTVLEGMNLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGSVLIGPTPVNIIGRNLLTQIGCTLNF
>AS-33| C16 | codons 1-99 | clone C16
PQITLWQRPLVTIRIGGQVTEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGSVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35I, R83K, D123E, I135T, K166R, R211K  
>AS-33| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>AS-33| C1 | codons 1-229 | clone C1
PISPIETVPVKLKPGMDGPKVKQRPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>AS-33| C2 | codons 1-229 | clone C2
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSGLEIGQHRTKIEELRQHLLKWGFTAPDKKHQKEPPFLW
>AS-33| C3 | codons 1-229 | clone C3
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLEWGFTTPDKKHQKEPPFLW
>AS-33| C4 | codons 1-229 | clone C4
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRRHLLKWGFTTPDKKHQKEPPFLW
>AS-33| C5 | codons 1-229 | clone C5
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKVEELRQHLLKWGFTTPDKKHQKEPPFLW
>AS-33| C6 | codons 1-229 | clone C6
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>AS-33| C7 | codons 1-229 | clone C7
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKNHQKEPPFLW
>AS-33| C8 | codons 1-229 | clone C8
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGPDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>AS-33| C9 | codons 1-229 | clone C9
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQSPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>AS-33| C10 | codons 1-229 | clone C10
PTSPIETVPVKLKPGMDGPKVKQWPLTEE*IKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYIAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGLTTPDKKHQKEPPFLW
>AS-33| C11 | codons 1-229 | clone C11
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQNSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>AS-33| C12 | codons 1-229 | clone C12
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKIPKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFAIPSTTNEPPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRNQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>AS-33| C13 | codons 1-229 | clone C13
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPA
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKVEELRQHLLKWGFTTPDKKHQKEPPFLW
>AS-33| C14 | codons 1-229 | clone C14
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIRPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDF*EVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQG*KGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVRSDLEIRQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>AS-33| C15 | codons 1-229 | clone C15
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEEKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKVEELRQHLLKWGFTTPDKKHQKEPPFLW
>AS-33| C16 | codons 1-229 | clone C16
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQNSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW

References
Author Title Citation
Saah, AJ Treatment with indinavir, efavirenz, and adefovir after failure of nelfinavir therapy. J Infect Dis, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005