<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
28241_300 28241_300 Uganda 2009 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Y115F   V106A, Y181C   V35T, V60I, T69N, D121Y, K122E, I142V, D177E, I178M, G196E, T200I, E203Q, Q207D, R211K, V245K, D250E, A272P, L282C, L283I, T286A, I293V  
>28241_300| codons 8-300
VPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPIFAIKRKD
SNKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSATVLDVGDAFFSVPLYEDFRKY
TAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVICQYMDDL
YVGSDLEIEQHRIKIQELRDHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIKLP
EKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKCIRGAKALTEVVPLTEEAE

References
Author Title Citation
Kekitiinwa, A Virologic response to first-line efavirenz- or nevirapine-based anti-retroviral therapy in HIV-infected African children. Pediatr Infect Dis J, 2017