<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
B105781R16 B105781R16 Uganda 2013 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, R41K, D60E, I64V, K70R  
>B105781R16| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYE
QILVEICGHRAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V35T, K49R, V60I, S68N, D121Y, K122E, R125K, S162A, D177E, I178M, V189I, Q207E, R211K, V245E, D250E, A272P, L282C, L283I, I293V, V317A  
>B105781R16| codons 1-320
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDNTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFKKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPEMVI
YQYMDDLYIGSDLEIGQHRTKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKCIRGTKALTEVVPLTEEAE
LELAENREILKEPVHGAYYD

References
Author Title Citation
Reynolds, SJ Low rates of transmitted drug resistance among newly identified HIV-1 seroconverters in rural Rakai,Uganda. ARHR, 2016