<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AS-26 AS-26 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+3TC+NFV 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D Q61E, I62V, L63P, V77I, I93L  
>AS-26| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADNTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
EVPIEICGHKAIGTVLIGPTPVNIIGRDLLTQLGCTLNF
>AS-26| C1 | codons 1-99 | clone C1
PQITLWQRPLVTIKIGGQLKEALLDTGADNTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
EVPIEICGHKAIGTVLIGPTPVNIIGRDLLTQLGCTLNF
>AS-26| C2 | codons 1-99 | clone C2
PQITLWQRPLVTIKIGGQLKEALLDTGADNTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
EVPIEICGHKAIGTVLIGPTPVNIIGRDLLTQLGCTLNF
>AS-26| C3 | codons 1-99 | clone C3
PQITLWQRPLVTIKIGGQLKEALLDTGADNTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
EVPIEICGHKAIGTVLIGPTPVNIIGRDLLTQLGCTLNF
>AS-26| C4 | codons 1-99 | clone C4
PQITLWQRPLVAIKIGGQLKEALLDTGADNTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
EVPIEICGHKAIGTVLIGPIPVNIIGRDLLTQLGCTLNF
>AS-26| C5 | codons 1-99 | clone C5
PQITLWQRPLVTIKIGGRLKEALLDTGADNTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
EVPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF
>AS-26| C6 | codons 1-99 | clone C6
PQITLWQRPLVTIKIGGQLRGALLDTGADNTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
EVPIEICGHKAIGTVLIGPTPVNIIGRDLLTQLGCTLNF
>AS-26| C7 | codons 1-99 | clone C7
PQITLWQRPLVTIKIGGQLKEALLDTGADNTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
EVPIEICGHKAIGTVLIGPTPVNIIGRDLLTQLGCTLNF
>AS-26| C8 | codons 1-99 | clone C8
PQITLWQRPLVTIKIGGQLKEALLDTGADNTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
EVPIEICGHKAIGTVLIGPTPVNIIGRDLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V       K11R, K122E, E169D, G196E, T200I  
>AS-26| codons 1-229
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRIKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>AS-26| C1 | codons 1-229 | clone C1
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRIKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>AS-26| C2 | codons 1-229 | clone C2
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>AS-26| C3 | codons 1-229 | clone C3
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRIKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>AS-26| C4 | codons 1-229 | clone C4
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYDVLPQGWKGSPAIFQSSMTKILDSFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRIKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>AS-26| C5 | codons 1-229 | clone C5
PISPIEPVPVRLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DGNFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVT
YQYVDDLYVGSDLEIEQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>AS-26| C6 | codons 1-229 | clone C6
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRIKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>AS-26| C7 | codons 1-229 | clone C7
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGSKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRIKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>AS-26| C8 | codons 1-229 | clone C8
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRIKIEELRQHLLRWGFTTPDKKHQKEPPFLW

References
Author Title Citation
Saah, AJ Treatment with indinavir, efavirenz, and adefovir after failure of nelfinavir therapy. J Infect Dis, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005