<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AS-25 AS-25 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 37
2 AZT+DDC 123
3 DDC 56
4 3TC+DDI 19
5 None 4
6 D4T+NFV 40
7 D4T+DDI+NFV 66

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D I13V, E35D, M36I, N37C, I62V, L63P, I72T  
>AS-25| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADNTVLEDICLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKATGTVLVGPTPVNIIGRDLLTQIGCTLNF
>AS-25| C1 | codons 1-99 | clone C1
PQITLWQRPLVTVKIGGQLKEALLDTGADNTVLGDICLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKATGTVLVGPTPVNIIGRDLLTQIGCTLNF
>AS-25| C2 | codons 1-99 | clone C2
PQITLWQRPLVTVKIGGQLKEALLDTGADNTVLEDICLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKATGTVLVGPTPVNIIGRDPLTQIGCTLNF
>AS-25| C3 | codons 1-99 | clone C3
PQITLWQRPLVTVKIGGQLKEALLDTGADNTVLEDICLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKTTGTVLVGPTPVNIIGRDLLTQIGCTLNF
>AS-25| C4 | codons 1-99 | clone C4
PQITLWQRPLVTVKIGGQLKEALLDTGADNTVLEEMCLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKTTGTVLVGPTPVNIIGRDLLTQIGCTLNF
>AS-25| C5 | codons 1-99 | clone C5
PQIALWQRPLVTVKIGGQLKEALLDTGADNTVLEDICLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKATGTVLVGPTPVNIIGRDLLTQIGCTLNF
>AS-25| C6 | codons 1-99 | clone C6
PQITLWQRPLVTVKIGGQLKEALLDTGADNTVLEDICLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKATSTVLVGPTPVNIIGRDLLTQIGCTLNF
>AS-25| C7 | codons 1-99 | clone C7
PQITLWQRPLVTVKIGGQLKEALLDTGADNTVLEDICLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKTTGTVLVGPTPVNIIGRDLLTQIGCTLNF
>AS-25| C8 | codons 1-99 | clone C8
PQITLWQRPLVTVKIGGQLKEALLDTGADNTVLEDICLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKATGTVLVGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215F K219Q     V35M, I50V, K104N, I135T, I178M  
>AS-25| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTELEKEGKISKVGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKNSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFFTPDQKHQKEPPFLW
>AS-25| C1 | codons 1-229 | clone C1
PISPIETVPVKLEPGMDGPKVKQWPLTEEKIKALMEICTELEKEGKISKVGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKNSVTVLDVGDAYSSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIGQHRTKIEGLRRHLLRWGFFTPDQKHQKEPPFLW
>AS-25| C2 | codons 1-229 | clone C2
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTELEEEGKISKVGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKNSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFFTPDQKHQKEPPFLW
>AS-25| C3 | codons 1-229 | clone C3
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTELEKEGKISKVGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKNSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFSTLDQKHQKEPPFLW
>AS-25| C4 | codons 1-229 | clone C4
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTELEKEGKISKVGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKNSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFFTPDQKHQKEPPFLW
>AS-25| C5 | codons 1-229 | clone C5
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTELEKEGKISKVGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKNSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFFTPDQKHQKEPPFLW
>AS-25| C6 | codons 1-229 | clone C6
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTELEKEGKISKVGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKNSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFFTPDQKHQKEPPFLW
>AS-25| C7 | codons 1-229 | clone C7
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTELEREGKISKVGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKNSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFFTPDQKHQKEPPFLW
>AS-25| C8 | codons 1-229 | clone C8
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTELEKEGKISKVGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKNSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMAKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFFTPDQKHQKEPPFLW

References
Author Title Citation
Saah, AJ Treatment with indinavir, efavirenz, and adefovir after failure of nelfinavir therapy. J Infect Dis, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005