<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AS-23 AS-23 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 4
2 DDI 47
3 None 10
4 D4T 26
5 3TC+D4T 56
6 DDC+DDI+NFV 13
7 D4T+DDI+NFV 43

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L210W, T215Y       T39A, K122E, D177E, G196E, R211K  
>AS-23| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLW
>AS-23| C1 | codons 1-229 | clone C1
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQYLWKWGFYTPDKKHQKEPPFLW
>AS-23| C2 | codons 1-229 | clone C2
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FAMKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLWRWGFYTPDKKHQKEPPFLW
>AS-23| C3 | codons 1-229 | clone C3
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQYLWKWGFYTPDKKHQKEPPFLW
>AS-23| C4 | codons 1-229 | clone C4
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIEQHGTKIEELRQHLWKWGFYTPDKKHQKEPPFLW
>AS-23| C5 | codons 1-229 | clone C5
PIGPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKAVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRRQNPEIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLW
>AS-23| C6 | codons 1-229 | clone C6
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLW
>AS-23| C7 | codons 1-229 | clone C7
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQYLWKWGFYTPDKKHQKEPPFLW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I N88D L10I, N37S, D60E, I62V, L63A, V77I, I93L  
>AS-23| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKIIGGIGGFIKVRQYE
QVAIEICGHKAIGTVLIGPTPVNIIGRDLLTQLGCTLNF
>AS-23| C1 | codons 1-99 | clone C1
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKIIGGIGGFIKVRQYE
QVAIEICGHKAIGTVLIGPTPVNIIGRSLLTQLGCTLNF
>AS-23| C2 | codons 1-99 | clone C2
PQITLWQRPIVTIKIGGQLKEALLDTGADNTVLEEMTLPGRWKPKMIGGIGGFIKVRQYE
QVAIEICGHKAIGTVLIGPTPVNIIGRDLLTQLGCTLNF
>AS-23| C3 | codons 1-99 | clone C3
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKIIGGIGGFIKVRQYE
QVAIEICGHKAIGTVLIGPTPVNIIGRSLLTQLGCTLNF
>AS-23| C4 | codons 1-99 | clone C4
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKIIGGIGGFIKVRQYE
QVTIEICGHKAIGTVLIGPTPVNIIGRSLLTQLGCTLNF
>AS-23| C5 | codons 1-99 | clone C5
PQITLWQRPIVTIKIGGQLKEALLDTGADNTVLEEMTLPGRWKPKMIGGIGGFIKVRQYE
QVAIEICGHKAIGTVLIGPTPVNIIGRDLLTQLGCTLNF
>AS-23| C6 | codons 1-99 | clone C6
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKIIGGIGGFIKVRQYE
QVAIEICGHKAIGTVLIGPTPVNIIGRSLLAQLGCTLNF
>AS-23| C7 | codons 1-99 | clone C7
PQITLWQRPIVTIKIGGQLKEALLDTGADNTVLEEMTLPGRWKPKMIGGIGGFIKVRQYE
QVAIEICGHKAIGTVLIGPTPVNIIGRDLLTQLGCTLNF

References
Author Title Citation
Saah, AJ Treatment with indinavir, efavirenz, and adefovir after failure of nelfinavir therapy. J Infect Dis, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005