<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AS-22 AS-22 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 8
2 3TC+D4T 26
3 D4T+DDI+NFV 78

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   I13V, Q18L, K20R, E35D, M36I, K45Q  
>AS-22| codons 1-99
PQITLWQRPLVTVKIGGLLREALLDTGADNTVLEDINLPGRWKPQMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>AS-22| C1 | codons 1-99 | clone C1
PQITLWQRPLVTVKIGGLLREALLDTGADNTVLEDINLPGRWKPQMIGGIGGFIKVRQYD
QIQVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>AS-22| C2 | codons 1-99 | clone C2
PQITLWQRPLVTVKIGGLLREALLDTGADNTVLEDVNLPGRWKPQMIGGIGGFIKVRQYD
QIQVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>AS-22| C3 | codons 1-99 | clone C3
PQITLWQRPLVTVKIGGLLREALLDTGADNTVLEDINLPGRWKPQMIGGIGGFIKVRQYD
QVQVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>AS-22| C4 | codons 1-99 | clone C4
PQITLWQRPLVTVKIGGQPREALLDTGADNTVLEDINLPGRWRPQMIGGIGGFIKVRQYD
QVQVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>AS-22| C5 | codons 1-99 | clone C5
PQITLWQRPLVTVKIGGLLREALLDTGADNTVLEDINLPGRWKPQMIGGIGGFIKVRQYD
QVQVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>AS-22| C6 | codons 1-99 | clone C6
PQITLWQRPLVTVKIGGLLREALLDTGADNTVLEDINLPGRWKPQMIGGIGGFIKVRQYD
QVQVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>AS-22| C7 | codons 1-99 | clone C7
PQITLWQRPLVTVKIGGLLREALLDTGADNTVLEDINLPGRWKPQMIGGIGGFIKVRQYD
QVQVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>AS-22| C8 | codons 1-99 | clone C8
PQITLWQRPLVTVKIGGLLREALLDTGADNTVLEDINLPGRWKPQMIGGIGGFIKVRQYD
QVQVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N       V35I, T39A, R83K, A98S, D123E, D177E, I178V, T200A, Q207E  
>AS-22| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAEMEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKKTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEVVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLW
>AS-22| C1 | codons 1-229 | clone C1
PISPIETVPVKLKPGMDGPKVKQWPLTEGKIKALIEICAEMEKEGKISKIGPESPYNTPV
FAIKKKNSTKWRKLVDFRELNKKTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNGTPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEVVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFIW
>AS-22| C2 | codons 1-229 | clone C2
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAEMEKEGKISKIGPESPYNTPV
FAIKKKNSTRWRKLVDFRELNKKTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEVVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLW
>AS-22| C3 | codons 1-229 | clone C3
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAEMEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKKTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEVVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLW
>AS-22| C4 | codons 1-229 | clone C4
PISPIETVPVKLKPGMDGPKVKQWPVTEEKIKALVETCAEMEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKKTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKVLEPFRKQNPEVVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLW
>AS-22| C5 | codons 1-229 | clone C5
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAEMEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKKTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEVVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLW
>AS-22| C6 | codons 1-229 | clone C6
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAEMEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKKTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEVVI
YQYMDDLYVGSDLEIGQHRAKIKELREHLLRWGFTTPDKKHQKEPPFLW
>AS-22| C7 | codons 1-229 | clone C7
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAEMEKEGKISKIEPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKKTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEVVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLW
>AS-22| C8 | codons 1-229 | clone C8
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKKTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEVVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLW

References
Author Title Citation
Saah, AJ Treatment with indinavir, efavirenz, and adefovir after failure of nelfinavir therapy. J Infect Dis, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005