<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I47A   T12P, I13V, N37D, R57K, L63P, A71T, V82I  
>165220| codons 1-99
PQITLWQRPLVPVKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKLAGGIGGFIKVKQYD
QIPIEICGHKTIGTVLVGPTPINIIGRNLLTQIGCTLNF

References
Author Title Citation
Kagan, RM Structural analysis of an HIV-1 protease I47A mutant resistant to the protease inhibitor lopinavir. Protein Sci, 2005
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005