<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
01rev 01rev Cameroon 2001 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39M, V60VI, S68G, V90I, S162A, K173T, Q174K, D177E, I178M, T200A, Q207G, R211K, V245E  
>01rev| codons 4-248
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICMEMEKEGKISKIGPENPYNTPIFAI
KKKDGTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKD
FRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEMVIYQY
MDDLYVGSDLEIGQHRAKIEELRGHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQP
IELPE

References
Author Title Citation
Njouom, R Assessment of HIV-1 subtyping for Cameroom strains using phylogenetic analysis of pol gene sequences. J Virol Methods, 2003