<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
44pol 44pol Cameroon 2001 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6K, K20R, V35T, E36ED, V118I, K122E, I135V, T139A, S162A, K173V, Q174N, N175H, D177E, T200A, Q207E, R211K, F214L F77I
>44pol| codons 1-239
PISPIKTVPVKLKPGMDGPRVKQWPLTEEKIKALTDICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDIRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSVNNEAPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRVNHPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, I15K, G16E, K20I, E34A, M36I, R41K, H69K, V77I  
>44pol| codons 9-99
PVVTVKKEGQLIEALLDTGADDTVLAEINLPGKWKPKMIGGIGGFIKVRQYDQILIEICG
KKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Njouom, R Assessment of HIV-1 subtyping for Cameroom strains using phylogenetic analysis of pol gene sequences. J Virol Methods, 2003