<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
27pol 27pol Cameroon 2001 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14N, K20R, L33V, E35D, M36I, R41K, R57K, D60E, I62V, L63P, H69Q D25DH
>27pol| codons 12-99
TINIGGQLREALLHTGADDTVVEDINLPGKWKPKMIGGIGGFIKVKQYEQVPIEICGQKA
IGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39K, K43Q, I47L, D123E, I142V, K173A, Q174K, D177E, Q207E, R211K F227FV
>27pol| codons 1-227
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICKEMEQEGKLSKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFTTPDKKHQKEPPV

References
Author Title Citation
Njouom, R Assessment of HIV-1 subtyping for Cameroom strains using phylogenetic analysis of pol gene sequences. J Virol Methods, 2003