<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BM-50 BM-50 France 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI 52
2 3TC+AZT+RTV 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67~, K70R, M184V, T215Y T69G, K219E     V35I, E36K, K122E, D123N, I135T, A158S, G196E, E203K, R211G  
>BM-50| codons 30-239
KIKALIKICTELEKEGKISKIGPENPYNTPVFAIKKK~SGRWRKLVDFRELNKRTQDFWE
VQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSTNNETPGIRYQYNVL
PQGWKGSPSIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRTKIKELRQHL
LGWGFYTPDEKHQKEPPFLWMGYELHPDKW

References
Author Title Citation
Masquelier, B Genotypic and phenotypic resistance patterns of human immunodeficiency virus type 1 variants with insertions or deletions in the reverse transcriptase (RT): multicenter study of patients treated with RT inhibitors. AAC, 2001
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005