<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BM-28 BM-28 France 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI 52
2 3TC+D4T+NFV 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69G_SG, T215Y     A98G V35I, D123E, S162C, D177E, I178L, D237X  
>BM-28| codons 17-241
DGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSGKWRKLVD
FRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSIN
NETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPELVIYQYMDDLYVGSDLEIG
QHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPXKWTV

References
Author Title Citation
Masquelier, B Genotypic and phenotypic resistance patterns of human immunodeficiency virus type 1 variants with insertions or deletions in the reverse transcriptase (RT): multicenter study of patients treated with RT inhibitors. AAC, 2001
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005