<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BM-19 BM-19 France 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 RTI NA
2 APV+ ABC+ EFV+ D4T NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69T_ST, L74LV, L210W, T215Y   K103N, Y181C, G190A K238KN K32KR, R83K, K122E, D123DN, Q207E, R211K, L228H  
>BM-19| codons 11-241
KLKPGMDGPKVKQWPLTEEKIRALVEICTELEKEGKISKIGPENPYNTPVFAIKKKDSTK
WRKVVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDENFRKYTAF
TIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVA
SDLEIGQHRTKIEELREHLWKWGFYTPDKKHQKEPPFHWMGYELHPDNWTV

References
Author Title Citation
Masquelier, B Genotypic and phenotypic resistance patterns of human immunodeficiency virus type 1 variants with insertions or deletions in the reverse transcriptase (RT): multicenter study of patients treated with RT inhibitors. AAC, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005