<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BM-9 BM-9 France 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI NA
2 NFV+ D4T NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69S_CA, L74V, L210W, T215F V75L G190Q V179D K20R, V118I, K122E, D123E, I135V, G196K, T200I, H208Y, R211K, E224G, T240A C38G
>BM-9| codons 7-251
TVPVKLKPGMDGPRVKQWPLTEEKIKALVEIGTELEKEGKISKIGPENPYNTPVFAIKKK
NSSKWRKVLDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPLDEEFRK
YTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIDIYQYMDD
LYVQSDLEIKQHRIKIEELRQYLWKWGFFTPDKKHQKGPPFLWMGYELHPDKWAVQPIVL
PEKDS

References
Author Title Citation
Masquelier, B Genotypic and phenotypic resistance patterns of human immunodeficiency virus type 1 variants with insertions or deletions in the reverse transcriptase (RT): multicenter study of patients treated with RT inhibitors. AAC, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005