<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NC13 NC13 Zimbabwe 2015 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ABC+LPV 202
2 3TC+NVP+TDF 258

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Y115F   V106M F227L K20R, K22R, V35T, T39E, S68N, W88C, V118I, K122E, E138A, S162A, T165I, E169Q, K173T, Q174K, N175Y, I178L, T200A, Q207E, R211K, F214L, H221Y  
>NC13| codons 1-237
PISPIETVPVKLKPGMDGPRVRQWPLTEEKIKALTEICEEMEKEGKISKIGPENPYNTPV
FAIKRKDNTKWRKLVDFRELNKRTQDFCEVQLGIPHPAGLKKKKSMTVLDVGDAFFSIPL
DEDFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQASMIKILQPFRTKYPDLVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDKKYQKEPPLLWMGYELHPD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, M36I, R41K, D60E, I62V, L63P, H69K, L89M, I93L  
>NC13| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYE
QVPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Chimukangara, B HIV drug resistance testing among patients failing second line antiretroviral therapy. Comparison of in-house and commercial sequencing. J Virol Methods, 2016