<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
HM_V6 HM_V6 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 RTV|SQV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L76V, I84V   L10V, K20I, M36I, L63P, A71V  
>HM_V6| codons 1-99
PQITLWQRPVVTIKIGGQLIEALLDTGADDTVLEEINLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKVIGTVVVGPTPVNVIGRNLLTQIGCTLNF

References
Author Title Citation
Mo, H Identification and structural characterization of I84C and I84A mutations that are associated with high-level resistance to HIV protease inhibitors and impair viral replication. AAC, 2006
Rhee, SY Distribution of human immunodeficiency virus type 1 protease and reverse transcriptase mutation patterns in 4,183 persons undergoing genotypic resistance testing. AAC, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005