<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
83334 83334 Zimbabwe 2010 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215Y   V106M, M230L Y188F, F227L E44ED, L109LI, D121H, K122E, K173A, Q174R, D177E, T200E, E203K, Q207E, R211K  
>83334| codons 41-238
MEKDGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGL
KKKKSMTVIDVGDAYFSVPLHEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRARNPEIVIYQYVDDLFVGSDLEIGQHREKIKELREHLLKWGFYTPDKK
HQKEPPLLWLGYELHPDK

References
Author Title Citation
Kityo, C HIV drug resistance mutations in non-B subtypes after prolonged virological failure on NNRTI-based first-line regimens in sub-Saharan Africa. JAIDS, 2017