<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
83240 83240 Malawi 2011 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103KNRS, V106VAMT F227L S48T, K102Q, K104KR, K122E, D123N, I135IL, K173T, Q174K, T200A, Q207E, R211K, F214L  
>83240| codons 41-238
MEKEGKITKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGL
KQNRSATVLDVGDAYFSVPLDENFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRTKNPDIVIYQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDKK
HQKEPPLLWMGYELHPDK

References
Author Title Citation
Kityo, C HIV drug resistance mutations in non-B subtypes after prolonged virological failure on NNRTI-based first-line regimens in sub-Saharan Africa. JAIDS, 2017