<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
HZ09S0082 HZ09S0082 China 2013 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, M36I, R41K, I62V, H69K, L89I  
>HZ09S0082| codons 7-99
QRPLVTVKIGGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQVLIEI
CGKKAIGTVLVGPTPVNIIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  K219K*EQ     E6D, K11T, V21I, V35T, T39K, K64R, K122E, D123S, I135V, S162C, K173I, Q174K, D177E, Q207S, R211S, K238R, V245E  
>HZ09S0082| codons 1-254
PISPIDTVPVTLKPGMDGPKIKQWPLTEEKIKALTEICKEMEKEGKISKIGPENPYNTPV
FAIRKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRIKNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRSHLLSWGFTTPD*KHQKEPPFLWMGYELHPDRWT
VQPIELPEKDSWTV

References
Author Title Citation
Zhang, J Genetic characteristics of CRF01_AE among newly diagnosed HIV-1-infected 16- to 25-year olds in 3 geographic regions of Guangxi, China. Medicine (Baltimore), 2015