<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BRP2052 BRP2052 Brazil 2001 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12N, I15V, E35D, M36I, R41K, R57K, Q61N, L63C, E65D, C95S  
>BRP2052| codons 1-98
PQITLWQRPLVNIKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
NICIDICGHKAIGTVLVGPTPVNIIGRNLLTQIGSTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        D123E, I135L, S162W, E169D, K173A, Q174R, T200A, Q207E, R211K  
>BRP2052| codons 36-225
EICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIP
HPAGLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKG
SPAIFQWSMTKILDPFRARNPDIVIYQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFT
TPDKKHQKEP

References
Author Title Citation
Soares, MA A specific subtype C of human immunodeficiency virus type 1 circulates in Brazil. AIDS, 2003