<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BRBS465 BRBS465 Brazil 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14KR, G16E, E35D, M36L, I62V, L63H, I64V  
>BRBS465| codons 1-87
PQITLWQRPLVTIRIEGQLKEALLDTGADDTVLEDLNLPGRWKPKMIGGIGGFIKVRQYD
QVHVEICGHKAIGTVLVGPTPVNIIGR

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        D86DN, I135T, T200A, E204D  
>BRBS465| codons 32-230
KALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQNFWEVQ
LGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQ
GWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRAKIEDLRQHLLR
WGFTTPDKKHQKEPPFLWM

References
Author Title Citation
Soares, MA A specific subtype C of human immunodeficiency virus type 1 circulates in Brazil. AIDS, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005