<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2005290_05 2005290_05 Kenya 2005 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, M36I, R41K, R57K, L63I, H69K, L89M  
>2005290_05| codons 29-99
DDTVLEDINLPGKWKPKMIGGIGGFIKVKQYDQIIIEICGKKAIGTVLVGPTPVNIIGRN
MLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, V60I, K122E, D123S, I135T, K173S, Q174K, D177E, G196E, Q207D, R211S  
>2005290_05| codons 1-228
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIVI
YQYMDDLYVGSDLEIEQHRTKIEELRDHLLSWGFTTPDKKHQKEPPFL

References
Author Title Citation
Zeh, C Molecular epidemiology and transmission dynamics of recent and long-term HIV-1 infections in rural western Kenya. PLoS ONE, 2016