<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1392 CA3645 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC+ AZT 69
2 AZT+ 3TC 56
3 RTV+ AZT+ 3TC 43
4 SQV+ RTV+ AZT+ 3TC 17
5 SQV+ NFV+ D4T+ 3TC 21
6 NVP+ DDI+ D4T 22

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M   L10V, I15V, L19V, E35D, M36I, D60E, Q61D, L63P, A71V  
>CA3645| codons 1-99
PQITLWQRPVVTIKVGGQVKEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFVKVRQYE
DIPIEICGHKVIGTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, D67N, K70R, T215F K219E K103N, Y181YC, G190GA   V35Q, T39A, S68SG, D123E, I135T, I142V, K166R, D177E, V179X, G196E, E203D, A272P, K277R  
>CA3644| codons 1-280
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALQEICAELEKEGKISKIGPENPYNTPV
FAIKKKNGTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPEIXI
CQYMDDLYVASDLEIEQHRTKIDELRQHLLRWGFFTPDEKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLC

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005