<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1390 CA3641 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 156
2 AZT+DDI 25
3 AZT 82
4 3TC+D4T 17
5 3TC+D4T+SQV 13
6 3TC+D4T+IDV 68

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, N88S   L10I, E35D, N37D, D60E, L63P, I64V, V77I, I93L  
>CA3641| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDMDLPGRWKPKIIGGIGGFIKVRQYE
QIPVEICGHKAIGTVLIGPTPVNIIGRSLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q     V35T, T39A, K64H, T69N, D177E, I178M, Q207N, R211K, A272P, T286A, I293V  
>CA3640| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGKISKIGPENPYNTPV
FAIHKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYVDDLYVGSDLEIGQHRTKIEELRNHLLKWGFTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVVPLTEEAE

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005