<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1389 CA3639 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 8
2 3TC+D4T+NVP 8
3 3TC+D4T+NFV 30

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19I, E35D, M36V, N37E, I62V, L63P, T74TA, Q92K  
>CA3639| codons 1-99
PQITLWQRPLVTIKIGGQIKEALLDTGADDTVLEDVELPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGAVLVGPTPVNIIGRNLLTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K101E, Y188YH, G190A   R83K, V106I, K166R, Q207A, R211K, A272P K201K*
>CA3638| codons 1-274
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLEKKKSITVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLHVASDLEIGQHRT*IEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGI

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005