<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TVGG28 TVGG28 Brazil 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 9
2 3TC+AZT 65
3 3TC+AZT+NNRTI 61
4 3TC+D4T+IDV 34

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82M, L90M Q58E I15V, L63P  
>TVGG28| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFVKVREYD
QIPIEICGHKAIGTVLVGPTPMNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219E P236L Y318F V118I, D121H, K122E, I135T, F214L, Q278R, T286P, K287R, I293V, E297K, E312A N265I, Y319I
>TVGG28| codons 1-320
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFTPDEKHQKEPPFLWMGYELHLDKWT
VQPIVLPEKDSWTVNDIQKLVGKLIWASQIYAGIKVKRLCKLLRGPRALTEVVPLTKEAE
LELAENREILKAPVHGVFID

References
Author Title Citation
Brindeiro, PA Testing genotypic and phenotypic resistance in human immunodeficiency virus type 1 isolates of clade B and other clades from children failing antiretroviral therapy. J Clin Microbiol, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005