<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CTLA329 CTLA329 India 2014 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, M184V V75I G190A A98G, V108I, F227L V35T, T39D, V60I, V118M, D121Y, K122E, I132L, S162A, K173A, D177E, T200A, I202V, Q207K, H208L, R211K, F214L, H221Y  
>CTLA329| codons 21-235
VKQWPLTEEKIKALTEICDELEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKIIDFREL
NKRTQDFWEVQLGIPHPGGLKKKKSVTILDVGDAYFSMPLYEDFRKYTAFTLPSINNETP
GIRYQYNVLPQGWKGSPAIFQASMTKILEPFRAQNPEIVIYQYVDDLYVASDLEIGQHRA
KVEELRKLLLKWGLTTPDKKYQKEPPLLWMGYELH

References
Author Title Citation
Saravanan, S Differences in evolution of HIV-1 subtype C reverse transcriptase between children and adults likely explained by maturity of cytotoxic T-lymphocyte responses. ARHR, 2015