<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TVSP22 TVSP22 Brazil 1999 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT 38
2 Unknown 66
3 AZT 25
4 AZT+DDI 43
5 Unknown 1
6 3TC+AZT 16
7 3TC+D4T 14
8 3TC+D4T+RTV 10
9 3TC+D4T 19
10 3TC+D4T+IDV 32
11 Unknown 2
12 3TC+D4T+NFV 39

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, E35D, M36I, R41K, Q61N, K70R, I72T, L89M  
>TVSP22| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
NILIEICGHRATGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35T, T39N, E40D, D123E, E169D, K173A, Q174K, Q207E, H208Y, R211K, V245Q, E248D, A272P, V276T, T286A, E291D, V292I, I293V, P294T, E297A, D324E  
>TVSP22| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICNDMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRAKNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREYLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKTKQLCKLLRGAKALTDIVTLTAEAE
LELAENREILKEPVHGVYYDPSKE

References
Author Title Citation
Brindeiro, PA Testing genotypic and phenotypic resistance in human immunodeficiency virus type 1 isolates of clade B and other clades from children failing antiretroviral therapy. J Clin Microbiol, 2002