<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TVSP6 TVSP6 Brazil 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 22
2 Unknown 9
3 3TC+AZT+RTV 51
4 3TC+D4T+NFV 12

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A   L10V, T12K, I15V, L19I, K20R, E35D, M36I, N37D, R57K, A71V  
>TVSP6| codons 1-99
PQITLWQRPVVKIKVGGQIREALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFVKVKQYD
QILIEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       E36D, I142V, T165K, K173Q, E203D, V245K, A272P, T286P, I293V, E297A  
>TVSP6| codons 1-322
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVDICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMKKILEPFRQQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIDELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGPKALTEVVPLTAEAE
LELAENREILKEPVHGVYYDPS

References
Author Title Citation
Brindeiro, PA Testing genotypic and phenotypic resistance in human immunodeficiency virus type 1 isolates of clade B and other clades from children failing antiretroviral therapy. J Clin Microbiol, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005