<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TVSP5 TVSP5 Brazil 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 6
2 3TC+AZT+RTV 20
3 3TC+D4T+RTV 45

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A   I15V, K20R, E35D, M36I, N37E, L63P, H69K, A71V  
>TVSP5| codons 1-99
PQITLWQRPLVTIKVGGQLREALLDTGADDTVLEDIELPGRWKPKMIGGIGGFVKVRQYD
QIPIEICGKKVIGTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Brindeiro, PA Testing genotypic and phenotypic resistance in human immunodeficiency virus type 1 isolates of clade B and other clades from children failing antiretroviral therapy. J Clin Microbiol, 2002
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005