Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| TVSP5 | TVSP5 | Brazil | 1999 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT | 6 |
| 2 | 3TC+AZT+RTV | 20 |
| 3 | 3TC+D4T+RTV | 45 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| I54V, V82A | I15V, K20R, E35D, M36I, N37E, L63P, H69K, A71V |
| >TVSP5| codons 1-99 PQITLWQRPLVTIKVGGQLREALLDTGADDTVLEDIELPGRWKPKMIGGIGGFVKVRQYD QIPIEICGKKVIGTVLVGPTPANIIGRNLLTQIGCTLNF |
References
| Author | Title | Citation |
| Brindeiro, PA | Testing genotypic and phenotypic resistance in human immunodeficiency virus type 1 isolates of clade B and other clades from children failing antiretroviral therapy. | J Clin Microbiol, 2002 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |