<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TVSP2 TVSP2 Brazil 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 92
2 3TC+AZT 31
3 3TC+D4T+RTV 72
4 D4T+NFV+NVP 11

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A   L10I, K20R, E35Q, M36I, N37D, R41K, D60E, L63P, A71V, I72V  
>TVSP2| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEQIDLPGKWKPKMIGGIGGFVKVRQYE
QIPIEICGHKVVGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    V106A, Y181C   V35M, T39A, E40D, S68G, D121H, K122E, D123S, I178L, R211K, F214L, V245E, A272P, K277R, T286A, I293V, E297K  
>TVSP2| codons 1-319
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICADMEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSATVLDVGDAYFSVPL
HESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLVI
CQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVVPLTKEAE
LELAENREILKEPVHGVYY

References
Author Title Citation
Brindeiro, PA Testing genotypic and phenotypic resistance in human immunodeficiency virus type 1 isolates of clade B and other clades from children failing antiretroviral therapy. J Clin Microbiol, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005