<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
117444 117444 Thailand 2011 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16E, K20I, E35D, M36I, N37D, R41K, K43R, L63P, H69K, K70R, L89I  
>117444| codons 1-99
PQITLWQRPLVTVKIEGQLIEALLDTGADDTVLEDIDLPGKWRPKMIGGIGGFIKVRQYD
QIPIEICGKRAIGTVLVGPTPVNIIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, V8I, V35T, T39K, K43E, K122E, D123S, K173T, Q174K, D177E, I178M, T200A, Q207A, R211S, K238R, V245E  
>117444| codons 1-265
PISPIDTIPVKLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEMVI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIELPEKDSWTVNDIQKLVGKLN

References
Author Title Citation
Saeng-Aroon, S Circulation of HIV-1 multiple complexity recombinant forms among female sex workers recently infected with HIV-1 in Thailand. ARHR, 2016