<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GART-NG38 GART-38 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI+ NRTI NA
2 AZT+ 3TC+ IDV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A   L10V, K14R, I15V, R41K, K55R, L63A, I72V  
>GART-38| codons 1-99
PQITLWQRPVVTIRVGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIRVRQYD
QIAIEICGHKAVGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215Y K219Q     V35T, K101KQ, K122E, I135T, I178M, T200I, Q207E, D250E  
>GART-38| codons 1-259
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYVDDLYVGSDLEIGQHRIKIEELREHLLRWGFYTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKESWTVNDIQK

References
Author Title Citation
Baxter, JD A randomized study of antiretroviral management based on plasma genotypic antiretroviral resistance testing in patients failing therapy. CPCRA 046 study team for the Terry Beirn community programs for clinical research on AIDS. AIDS, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005