<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
cw8 cw8-F2 Denmark 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA
2 ABC+ D4T+ DDI 64

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70E, Q151M       S68SG, S162C, Q197H, R211K, H221Y, I244K N54NK, N57Y, D113K
>cw8-F2| codons 38-247
CTEMEKEGKISKIGPEKPYYTPVFAIKKKDGTEWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGKAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSP
AIFQCSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGHHRTKIEELRQHLLKWGFTTP
DKKYQKEPPFLWMGYELHPDKWTVQPKVLP

References
Author Title Citation
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005
Roge, BT K65R with and without S68: a new resistance profile in vivo detected in most patients failing abacavir, didanosine and stavudine. Antivir Ther, 2003