<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ehh6 ehh6-F2 Denmark 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA
2 ABC+ D4T+ DDI 91

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R V75T, T215V, K219Q     K64Y, D123E, D177E, G196E, T200I, H208HY, R211K, D218E  
>ehh6-F2| codons 38-246
CTEMEKEGKISKIGPENPYNTPVFAIYKKNSTRWRKLTDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIVIYQYMDDLYVGSDLEIEQHRIKIEELRQYLLKWGFVTP
EQKHQKEPPFLWMGYELHPDKWTVQPIVL

References
Author Title Citation
Roge, BT K65R with and without S68: A new resistance profile in vivo detected in most patients failing abacavir, didanosine and stavudine. Antivir Ther, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005