<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
430132 430132+ U.S. 1995 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 AZT 5
2 D4T 78

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R       E6K, K20R, V35T, T39M, V60I, T69N, K122E, I135V, S162A, K173T, Q174N, D177E, I178M, T200A, Q207E, F214L, V245Q, T286A, E291D, V292I, I293V, P294T, I326V, G335D, R356RK, M357K, G359S, K366R, T369V, A371V, I375V, A376V, A400T, T403M, W410C, E432D, T470S, D471E, Q480H, L491S, K512R, S519N, Q524K, K527E, A534S, A554N  
>430132+| codons 1-560
PISPIKTVPVKLKPGMDGPRVKQWPLTEEKIKALTEICMEMEKEGKISKIGPENPYNTPI
FAIKKKDSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTNNPEMVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKRSA
HTNDVRQLVEVVQKVVTESIVIWGKTPKFKLPIQKETWETWWMEYWQATCIPEWEFVNTP
PLVKLWYQLEKDPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSLSETTNQKTELH
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDRSESELVNQIIEKLIEKEKVYLSWVPAHK
GIGGNEQVDKLVSNGIRKVL

References
Author Title Citation
Maxeiner, HG Selection of zidovudine resistance mutations and escape of human immunodeficiency virus type 1 from antiretroviral pressure in stavudine-treated pediatric patients. J Infect Dis, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005