<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EO-CA20 CA20 Cameroon 1993 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, T12A, I13V, K20R, E35D, M36I, R41K, D60E, I62V, L63P, H69Q  
>CA20| codons 5-99
LWQRPVVAVKIGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYEQVPI
EICGQKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, D123E, K173A, Q174K, D177E, Q207E, P243A, V245Q, E248D, D250S, A272P, K275R, Q278H, K281R, T286A  
>CA20| codons 1-289
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQAIQLPDKSSWTVNDIQKLVGKLNWASQIYPGIRVKHLCRLLRGAKAL

References
Author Title Citation
Op de Coul, E Independent introduction of transmissible F/D recombinant HIV-1 from Africa into Belgium and the Netherlands. Virology, 2000